PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00071.1_g00046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 361aa    MW: 40485.1 Da    PI: 5.2519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00071.1_g00046.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-151462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l+d+++  G+g +W + ++++g++R++k+c++rw++yl
  Rsa1.0_00071.1_g00046.1 14 KGPWSPEEDAKLKDYIENSGTGgNWIALPQKIGLRRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding38.52.6e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_00071.1_g00046.1  69 GGFSEEEDNIICNLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.624962IPR017930Myb domain
SuperFamilySSF466899.58E-2611109IPR009057Homeodomain-like
SMARTSM007177.9E-111364IPR001005SANT/Myb domain
PfamPF002494.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231569IPR009057Homeodomain-like
CDDcd001671.36E-71662No hitNo description
PROSITE profilePS5129421.38563117IPR017930Myb domain
SMARTSM007172.2E-1167115IPR001005SANT/Myb domain
PfamPF002496.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2470117IPR009057Homeodomain-like
CDDcd001675.40E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE NSGTGGNWIA LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC NLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLSK  120
QRKEFQEARM KQEMVMMKRQ QQGQNGSTDL YLKNMFGSSP WPLLQQLPPH QVPLVMMEPT  180
NCNYYQTSPS CNLEQKQPIA LNNMVKIEEE PERTNPDHHQ HQDSITNPFD VSFSQLLLDP  240
YYYLGSGEGG GEGDFAIMSS STNSPLPNTS GDQNEHQQQE IFQWFGSSNL QTEASSDMFL  300
NNNIANLETN EGTKFYSSLA GAGAALAGGT TSTSADQSTI SWEDITSLVN SEDASYFNGP  360
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274720.0AK227472.1 Arabidopsis thaliana mRNA for transcription factor like protein, complete cds, clone: RAFL14-10-M08.
GenBankAY5196470.0AY519647.1 Arabidopsis thaliana MYB transcription factor (At5g65790) mRNA, complete cds.
GenBankBT0059940.0BT005994.1 Arabidopsis thaliana At5g65790 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741705.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-129RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D3E2E00.0A0A0D3E2E0_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.8__2632__AT5G65790.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.11e-179myb domain protein 68